PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G405000.1.p
Common NamePRUPE_ppa016464mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family Trihelix
Protein Properties Length: 577aa    MW: 65319.7 Da    PI: 5.6984
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G405000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix926.1e-29380464186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         rW+++ev+aLi +r+++e+++++   k+p Weevs  m + g++rs+k+Ck+kwen+nk+++k+k+++kkr + + +tc+yf+ql+
  Prupe.1G405000.1.p 380 RWPQSEVKALILVRSSIESKFQEPGVKGPVWEEVSVLMGSMGYQRSAKRCKQKWENINKYFRKTKDSAKKR-PHNFKTCSYFNQLD 464
                         8*********************************************************************8.88889********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.632373437IPR017877Myb-like domain
PfamPF138372.4E-20379466No hitNo description
CDDcd122033.04E-26379444No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 577 aa     Download sequence    Send to blast
MQSNFDISEI GNQQHLMDIS NSCSPILPMF NHQKQNPHHP HFNQQLEQPE PYHISHLVHP  60
TPITHDLFQR QHLQALQQQG RLHWQLGPVN FKLGLNENSG NGESALLGAG LFDDENGDDP  120
RLLQSRMHNL GFKSWQTHEP MCWKPLDAAI PETNRKQKEA NEGDICKDLE NKYRLYGELE  180
AIYSLAKMGE ANQTGSGSAL TGENSPKNVD LPVPFCDPHD LNVAPTAQVR VDNGSEASIG  240
EESSPRKIEK RKRKRTMKKQ LSSVISFFES LVKQVMDHQE NLHKKYLEVI ERMDKERRER  300
EAAWRSQEAE NHKREAIAKV HEQALASSRE ALIVSYIEKI TGQRVNLPSR QAPLLLQPDN  360
LNEPPVEELT PFKIDHTNSR WPQSEVKALI LVRSSIESKF QEPGVKGPVW EEVSVLMGSM  420
GYQRSAKRCK QKWENINKYF RKTKDSAKKR PHNFKTCSYF NQLDQLYSGT PITAPSSSSS  480
YYSSNPSASM DDNIPKQGFS DLLEAFVAGR EAGVAHNLSS GNFEISEMGS NRLDFDGIIG  540
GKVEDVQGDL VKEKENREDD ENVDETEDTD DDDSDE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1245259RKIEKRKRKRTMKKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00651PBMTransfer from LOC_Os02g01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007224165.10.0hypothetical protein PRUPE_ppa016464mg
TrEMBLM5XHC80.0M5XHC8_PRUPE; Uncharacterized protein
STRINGPOPTR_0018s05520.11e-136(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF139981421
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.21e-47Trihelix family protein